PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G13570.1
Common NameNFYB7, NF-YB7, T10F5.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NF-YB
Protein Properties Length: 215aa    MW: 24619.1 Da    PI: 6.4165
Description nuclear factor Y, subunit B7
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G13570.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.33.4e-5635130297
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  +eqdrflPianv+rimkkvlP+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyv+plkvyl kyr++egek
  AT2G13570.1  35 KEQDRFLPIANVGRIMKKVLPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVAPLKVYLCKYRDTEGEK 130
                  89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-5428163IPR009072Histone-fold
SuperFamilySSF471131.02E-4137166IPR009072Histone-fold
PfamPF008084.1E-2840104IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.3E-186886No hitNo description
PROSITE patternPS0068507187IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.3E-1887105No hitNo description
PRINTSPR006152.3E-18106124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MTEESPEEDH GSPGVAETNP GSPSSKTNNN NNNNKEQDRF LPIANVGRIM KKVLPGNGKI  60
SKDAKETVQE CVSEFISFVT GEASDKCQRE KRKTINGDDI IWAITTLGFE DYVAPLKVYL  120
CKYRDTEGEK VNSPKQQQQR QQQQQIQQQN HHNYQFQEQD QNNNNMSCTS YISHHHPSPF  180
LPVDHQPFPN IAFSPKSLQK QFPQQHDNNI DSIHW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4435125292Transcription factor HapC (Eurofung)
4g92_B1e-4435125292Transcription factor HapC (Eurofung)
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263718_at0.0
Expression AtlasAT2G13570-
AtGenExpressAT2G13570-
ATTED-IIAT2G13570-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and green siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G13570.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G12480, AT3G48590, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G07980, AT1G08970, AT1G09030, AT1G54830, AT1G56170
IntActSearch Q9SIT9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G13570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0070630.0AC007063.6 Arabidopsis thaliana chromosome 2 clone T10F5 map PR1, complete sequence.
GenBankBT0252760.0BT025276.1 Arabidopsis thaliana At2g13570 mRNA, complete cds.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankDQ4464910.0DQ446491.1 Arabidopsis thaliana clone pENTR221-At2g13570 CCAAT-box binding transcription factor (At2g13570) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_178981.11e-161nuclear transcription factor Y subunit B-7
SwissprotQ9SIT91e-163NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLC0SV441e-161C0SV44_ARATH; Putative uncharacterized protein At2g13570 (Fragment)
TrEMBLA0MEK81e-161A0MEK8_ARATH; Putative uncharacterized protein (Fragment)
STRINGAT2G13570.11e-160(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Representative plantOGRP16817170
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of the CCAAT-Binding NF-Y subunits in Arabidopsis thaliana.
    Gene, 2001. 264(2): p. 173-85
    [PMID:11250072]
  3. Gusmaroli G,Tonelli C,Mantovani R
    Regulation of novel members of the Arabidopsis thaliana CCAAT-binding nuclear factor Y subunits.
    Gene, 2002. 283(1-2): p. 41-8
    [PMID:11867211]
  4. Kwong RW, et al.
    LEAFY COTYLEDON1-LIKE defines a class of regulators essential for embryo development.
    Plant Cell, 2003. 15(1): p. 5-18
    [PMID:12509518]
  5. Wenkel S, et al.
    CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 2971-84
    [PMID:17138697]
  6. Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
    Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations.
    Plant Biotechnol. J., 2006. 4(3): p. 317-24
    [PMID:17147637]
  7. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  8. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  9. Hackenberg D, et al.
    Studies on differential nuclear translocation mechanism and assembly of the three subunits of the Arabidopsis thaliana transcription factor NF-Y.
    Mol Plant, 2012. 5(4): p. 876-88
    [PMID:22199235]
  10. Calvenzani V, et al.
    Interactions and CCAAT-binding of Arabidopsis thaliana NF-Y subunits.
    PLoS ONE, 2012. 7(8): p. e42902
    [PMID:22912760]
  11. Sato H, et al.
    Arabidopsis DPB3-1, a DREB2A interactor, specifically enhances heat stress-induced gene expression by forming a heat stress-specific transcriptional complex with NF-Y subunits.
    Plant Cell, 2014. 26(12): p. 4954-73
    [PMID:25490919]